C16orf53 polyclonal antibody
  • C16orf53 polyclonal antibody

C16orf53 polyclonal antibody

Ref: AB-PAB23805
C16orf53 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C16orf53.
Información adicional
Size 100 uL
Gene Name C16orf53
Gene Alias FLJ22459|GAS|MGC4606|PA1
Gene Description chromosome 16 open reading frame 53
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PAEEDSEDWCVPCSDEEVELPADGQPWMPPPSEIQRLYELLAAHGTLELQAEILPRRPPTPEAQSEEERSDEEPEA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C16orf53.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79447
Iso type IgG

Enviar uma mensagem


C16orf53 polyclonal antibody

C16orf53 polyclonal antibody