SRRM2 polyclonal antibody
  • SRRM2 polyclonal antibody

SRRM2 polyclonal antibody

Ref: AB-PAB23801
SRRM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SRRM2.
Información adicional
Size 100 uL
Gene Name SRRM2
Gene Alias 300-KD|CWF21|DKFZp686O15166|FLJ21926|FLJ22250|KIAA0324|MGC40295|SRL300|SRm300
Gene Description serine/arginine repetitive matrix 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RSRSSSPVTELASRSPIRQDRGEFSASPMLKSGMSPEQSRFQSDSSSYPTVDSNSLLGQSRLETAESKEKMALPPQEDATASPPRQKDKFSPFPVQDRPESSLVFK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SRRM2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23524
Iso type IgG

Enviar uma mensagem


SRRM2 polyclonal antibody

SRRM2 polyclonal antibody