OTOA polyclonal antibody
  • OTOA polyclonal antibody

OTOA polyclonal antibody

Ref: AB-PAB23799
OTOA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OTOA.
Información adicional
Size 100 uL
Gene Name OTOA
Gene Alias DFNB22|FLJ32773|MGC157747|MGC39813
Gene Description otoancorin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RCMEEDTFIRTVELLGAVQGFSRPQLMTLKEKAIQVWDMPSYWREHHIVSLGRIALALNESELEQLDLSSIDTVASLSWQTEWTP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OTOA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146183
Iso type IgG

Enviar uma mensagem


OTOA polyclonal antibody

OTOA polyclonal antibody