RLTPR polyclonal antibody
  • RLTPR polyclonal antibody

RLTPR polyclonal antibody

Ref: AB-PAB23798
RLTPR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RLTPR.
Información adicional
Size 100 uL
Gene Name RLTPR
Gene Alias CARMIL2b|LRRC16C
Gene Description RGD motif, leucine rich repeats, tropomodulin domain and proline-rich containing
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EVNELCQSVQEHVELLGCGAGPQGEAAVRQAEDAIQNANFSLSILPILYEAGSSPSHHWQLGQKLEGLLRQVGEVCRQDIQDFTQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RLTPR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 146206
Iso type IgG

Enviar uma mensagem


RLTPR polyclonal antibody

RLTPR polyclonal antibody