DHX38 polyclonal antibody
  • DHX38 polyclonal antibody

DHX38 polyclonal antibody

Ref: AB-PAB23787
DHX38 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DHX38.
Información adicional
Size 100 uL
Gene Name DHX38
Gene Alias DDX38|KIAA0224|PRP16|PRPF16
Gene Description DEAH (Asp-Glu-Ala-His) box polypeptide 38
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DHX38.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9785
Iso type IgG

Enviar uma mensagem


DHX38 polyclonal antibody

DHX38 polyclonal antibody