KARS polyclonal antibody
  • KARS polyclonal antibody

KARS polyclonal antibody

Ref: AB-PAB23786
KARS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KARS.
Información adicional
Size 100 uL
Gene Name KARS
Gene Alias KARS2|KIAA0070|KRS
Gene Description lysyl-tRNA synthetase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq GMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KARS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3735
Iso type IgG

Enviar uma mensagem


KARS polyclonal antibody

KARS polyclonal antibody