OAS3 polyclonal antibody
  • OAS3 polyclonal antibody

OAS3 polyclonal antibody

Ref: AB-PAB23774
OAS3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OAS3.
Información adicional
Size 100 uL
Gene Name OAS3
Gene Alias MGC133260|p100
Gene Description 2'-5'-oligoadenylate synthetase 3, 100kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OAS3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4940
Iso type IgG

Enviar uma mensagem


OAS3 polyclonal antibody

OAS3 polyclonal antibody