DNAJC17 polyclonal antibody
  • DNAJC17 polyclonal antibody

DNAJC17 polyclonal antibody

Ref: AB-PAB23766
DNAJC17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAJC17.
Información adicional
Size 100 uL
Gene Name DNAJC17
Gene Alias FLJ10634
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NPRAAELFHQLSQALEVLTDAAARAAYDKVRKAKKQAAERTQKLDEKRKKVKLDLEARERQAQAQES
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAJC17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55192
Iso type IgG

Enviar uma mensagem


DNAJC17 polyclonal antibody

DNAJC17 polyclonal antibody