MPV17L polyclonal antibody
  • MPV17L polyclonal antibody

MPV17L polyclonal antibody

Ref: AB-PAB23765
MPV17L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MPV17L.
Información adicional
Size 100 uL
Gene Name MPV17L
Gene Alias FLJ39599|MGC70356|MLPH1|MLPH2
Gene Description MPV17 mitochondrial membrane protein-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SQQSGDGTFKSAFTILYTKGTSATEGYPKK
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MPV17L.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 255027
Iso type IgG

Enviar uma mensagem


MPV17L polyclonal antibody

MPV17L polyclonal antibody