TXNDC11 polyclonal antibody
  • TXNDC11 polyclonal antibody

TXNDC11 polyclonal antibody

Ref: AB-PAB23763
TXNDC11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TXNDC11.
Información adicional
Size 100 uL
Gene Name TXNDC11
Gene Alias EFP1
Gene Description thioredoxin domain containing 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PSLNHIFIQLARNLPMDTFTVARIDVSQNDLPWEFMVDRLPTVLFFPCNRKDLSVKYPEDVPITLPNLLRFILHHSDPASSPQNVANSPTKECLQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TXNDC11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51061
Iso type IgG

Enviar uma mensagem


TXNDC11 polyclonal antibody

TXNDC11 polyclonal antibody