KATNB1 polyclonal antibody
  • KATNB1 polyclonal antibody

KATNB1 polyclonal antibody

Ref: AB-PAB23761
KATNB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KATNB1.
Información adicional
Size 100 uL
Gene Name KATNB1
Gene Alias KAT
Gene Description katanin p80 (WD repeat containing) subunit B 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq SPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCVVLTSRHKNLDTVRAVWTMGDIKTSVDSAVAINDLSVV
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KATNB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10300
Iso type IgG

Enviar uma mensagem


KATNB1 polyclonal antibody

KATNB1 polyclonal antibody