ATF7IP2 polyclonal antibody
  • ATF7IP2 polyclonal antibody

ATF7IP2 polyclonal antibody

Ref: AB-PAB23757
ATF7IP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATF7IP2.
Información adicional
Size 100 uL
Gene Name ATF7IP2
Gene Alias FLJ12668|MCAF2
Gene Description activating transcription factor 7 interacting protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVESPNLTTPITSNPTDTRKITSGNSSNSPNAEVMAVQKKLDSIIDLTKEGLSNCNTESPVSPLESHSKAASNSKETTPLAQNAVQVPESFEHLPPLPEPPAPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATF7IP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80063
Iso type IgG

Enviar uma mensagem


ATF7IP2 polyclonal antibody

ATF7IP2 polyclonal antibody