PPP1R3D polyclonal antibody
  • PPP1R3D polyclonal antibody

PPP1R3D polyclonal antibody

Ref: AB-PAB23755
PPP1R3D polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPP1R3D.
Información adicional
Size 100 uL
Gene Name PPP1R3D
Gene Alias DKFZp781L2441|PPP1R6
Gene Description protein phosphatase 1, regulatory (inhibitor) subunit 3D
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPP1R3D.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5509
Iso type IgG

Enviar uma mensagem


PPP1R3D polyclonal antibody

PPP1R3D polyclonal antibody