C16orf46 polyclonal antibody
  • C16orf46 polyclonal antibody

C16orf46 polyclonal antibody

Ref: AB-PAB23754
C16orf46 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C16orf46.
Información adicional
Size 100 uL
Gene Name C16orf46
Gene Alias FLJ32702
Gene Description chromosome 16 open reading frame 46
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq NETDLENAENNEIQFTEETEPTYTCPDGKSEKNHVYCLLDVSDITLEQDEKAKEFIIGTGWEEAVQGWGRTSPAACIWPRKIPKKARVGEGACSDCLVCVNLSHW
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C16orf46.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 123775
Iso type IgG

Enviar uma mensagem


C16orf46 polyclonal antibody

C16orf46 polyclonal antibody