PSMF1 polyclonal antibody
  • PSMF1 polyclonal antibody

PSMF1 polyclonal antibody

Ref: AB-PAB23752
PSMF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSMF1.
Información adicional
Size 100 uL
Gene Name PSMF1
Gene Alias PI31
Gene Description proteasome (prosome, macropain) inhibitor subunit 1 (PI31)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq SSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSMF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9491
Iso type IgG

Enviar uma mensagem


PSMF1 polyclonal antibody

PSMF1 polyclonal antibody