CHORDC1 polyclonal antibody
  • CHORDC1 polyclonal antibody

CHORDC1 polyclonal antibody

Ref: AB-PAB23742
CHORDC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CHORDC1.
Información adicional
Size 100 uL
Gene Name CHORDC1
Gene Alias CHP1
Gene Description cysteine and histidine-rich domain (CHORD)-containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CHORDC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26973
Iso type IgG

Enviar uma mensagem


CHORDC1 polyclonal antibody

CHORDC1 polyclonal antibody