MACROD1 polyclonal antibody
  • MACROD1 polyclonal antibody

MACROD1 polyclonal antibody

Ref: AB-PAB23740
MACROD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MACROD1.
Información adicional
Size 100 uL
Gene Name MACROD1
Gene Alias LRP16
Gene Description MACRO domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SFLKGLSDKQREEHYFCKDFVRLKKIPTWKEMAKGVAVKVEEPRYKKDKQLNEKISLLRSDITKLEV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MACROD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 28992
Iso type IgG

Enviar uma mensagem


MACROD1 polyclonal antibody

MACROD1 polyclonal antibody