OTOL1 polyclonal antibody
  • OTOL1 polyclonal antibody

OTOL1 polyclonal antibody

Ref: AB-PAB23739
OTOL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OTOL1.
Información adicional
Size 100 uL
Gene Name OTOL1
Gene Alias -
Gene Description Otolin-1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SYHITVRGRPARISLVAQNKKQFKSRETLYGQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OTOL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 131149
Iso type IgG

Enviar uma mensagem


OTOL1 polyclonal antibody

OTOL1 polyclonal antibody