AGRP polyclonal antibody
  • AGRP polyclonal antibody

AGRP polyclonal antibody

Ref: AB-PAB23735
AGRP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AGRP.
Información adicional
Size 100 uL
Gene Name AGRP
Gene Alias AGRT|ART|ASIP2|MGC118963
Gene Description agouti related protein homolog (mouse)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAM
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AGRP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 181
Iso type IgG

Enviar uma mensagem


AGRP polyclonal antibody

AGRP polyclonal antibody