SLC9A5 polyclonal antibody
  • SLC9A5 polyclonal antibody

SLC9A5 polyclonal antibody

Ref: AB-PAB23734
SLC9A5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC9A5.
Información adicional
Size 100 uL
Gene Name SLC9A5
Gene Alias NHE5
Gene Description solute carrier family 9 (sodium/hydrogen exchanger), member 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ASPPCNQAPILTCLPPHPRGTEEPQVPLHLPSDPRSSFAFPPSLAKAGRSRSESSADLPQQQELQPLMGHKDHTHL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC9A5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6553
Iso type IgG

Enviar uma mensagem


SLC9A5 polyclonal antibody

SLC9A5 polyclonal antibody