ROGDI polyclonal antibody
  • ROGDI polyclonal antibody

ROGDI polyclonal antibody

Ref: AB-PAB23732
ROGDI polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ROGDI.
Información adicional
Size 100 uL
Gene Name ROGDI
Gene Alias FLJ22386
Gene Description rogdi homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VLEEEFRWLLHDEVHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLTLQGDALSQADVNLKMPRNN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ROGDI.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79641
Iso type IgG

Enviar uma mensagem


ROGDI polyclonal antibody

ROGDI polyclonal antibody