RMI2 polyclonal antibody
  • RMI2 polyclonal antibody

RMI2 polyclonal antibody

Ref: AB-PAB23731
RMI2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RMI2.
Información adicional
Size 100 uL
Gene Name RMI2
Gene Alias BLAP18|C16orf75
Gene Description RMI2, RecQ mediated genome instability 2, homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RMI2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 116028
Iso type IgG

Enviar uma mensagem


RMI2 polyclonal antibody

RMI2 polyclonal antibody