OCIAD2 polyclonal antibody
  • OCIAD2 polyclonal antibody

OCIAD2 polyclonal antibody

Ref: AB-PAB23730
OCIAD2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OCIAD2.
Información adicional
Size 100 uL
Gene Name OCIAD2
Gene Alias DKFZp686C03164|MGC45416
Gene Description OCIA domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GVCQSKFHFFEDQLRGAGFGPQHNRHCLLTCEECKIKHGLSEKGDSQPSAS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OCIAD2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 132299
Iso type IgG

Enviar uma mensagem


OCIAD2 polyclonal antibody

OCIAD2 polyclonal antibody