SAMD10 polyclonal antibody
  • SAMD10 polyclonal antibody

SAMD10 polyclonal antibody

Ref: AB-PAB23728
SAMD10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SAMD10.
Información adicional
Size 100 uL
Gene Name SAMD10
Gene Alias C20orf136|dJ591C20|dJ591C20.7
Gene Description sterile alpha motif domain containing 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MFTELRSKLSPPRGRAGAVRAGFGERRDVDATAHFSFCRTLLEHTVSAESIPCHLPRTPGTS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SAMD10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 140700
Iso type IgG

Enviar uma mensagem


SAMD10 polyclonal antibody

SAMD10 polyclonal antibody