NUTF2 polyclonal antibody
  • NUTF2 polyclonal antibody

NUTF2 polyclonal antibody

Ref: AB-PAB23725
NUTF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NUTF2.
Información adicional
Size 100 uL
Gene Name NUTF2
Gene Alias NTF2|PP15
Gene Description nuclear transport factor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NUTF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10204
Iso type IgG

Enviar uma mensagem


NUTF2 polyclonal antibody

NUTF2 polyclonal antibody