LSM4 polyclonal antibody
  • LSM4 polyclonal antibody

LSM4 polyclonal antibody

Ref: AB-PAB23720
LSM4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LSM4.
Información adicional
Size 100 uL
Gene Name LSM4
Gene Alias YER112W
Gene Description LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIID
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LSM4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25804
Iso type IgG

Enviar uma mensagem


LSM4 polyclonal antibody

LSM4 polyclonal antibody