FAM98C polyclonal antibody
  • FAM98C polyclonal antibody

FAM98C polyclonal antibody

Ref: AB-PAB23719
FAM98C polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM98C.
Información adicional
Size 100 uL
Gene Name FAM98C
Gene Alias FLJ44669
Gene Description family with sequence similarity 98, member C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EPGAGLRLLRFLCSELQATRLLCLRSLLDPSPRPPLGEGVVEGAGMVQELDLTLQALGLPRPAPGTPASQLLQELHA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM98C.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 147965
Iso type IgG

Enviar uma mensagem


FAM98C polyclonal antibody

FAM98C polyclonal antibody