UBXN6 polyclonal antibody
  • UBXN6 polyclonal antibody

UBXN6 polyclonal antibody

Ref: AB-PAB23712
UBXN6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UBXN6.
Información adicional
Size 100 uL
Gene Name UBXN6
Gene Alias DKFZp667D109|UBXD1|UBXDC2
Gene Description UBX domain protein 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq IYTFNKDQDRVKLGVDTIAKYLDNIHLHPEEEKYRKIKLQNKVFQERINCLEGTHEFFEAIGFQKVLLPAQDQEDPEEFYVLSET
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UBXN6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80700
Iso type IgG

Enviar uma mensagem


UBXN6 polyclonal antibody

UBXN6 polyclonal antibody