PGBD4 polyclonal antibody
  • PGBD4 polyclonal antibody

PGBD4 polyclonal antibody

Ref: AB-PAB23709
PGBD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PGBD4.
Información adicional
Size 100 uL
Gene Name PGBD4
Gene Alias FLJ32638|FLJ37497
Gene Description piggyBac transposable element derived 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VLTLVNDLLGQGYCVFLDNFNISPMLFRELHQNRTDAVGTARLNRKQIPNDLKKRIAKGTTVARFCGELMALKWCDGKEVTMLSTFHNDTVIEVNNRNGKKTKR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PGBD4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 161779
Iso type IgG

Enviar uma mensagem


PGBD4 polyclonal antibody

PGBD4 polyclonal antibody