NARFL polyclonal antibody
  • NARFL polyclonal antibody

NARFL polyclonal antibody

Ref: AB-PAB23706
NARFL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NARFL.
Información adicional
Size 100 uL
Gene Name NARFL
Gene Alias FLJ21988|HPRN|IOP1|LET1L|PRN
Gene Description nuclear prelamin A recognition factor-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KLEASRPDFFNQEHQTRDVDCVLTTGEVFRLLEEEGVSLPDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHVAEVTYKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NARFL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64428
Iso type IgG

Enviar uma mensagem


NARFL polyclonal antibody

NARFL polyclonal antibody