GRXCR1 polyclonal antibody
  • GRXCR1 polyclonal antibody

GRXCR1 polyclonal antibody

Ref: AB-PAB23701
GRXCR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GRXCR1.
Información adicional
Size 100 uL
Gene Name GRXCR1
Gene Alias -
Gene Description glutaredoxin, cysteine rich 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GVKYKVSAGQALFNNLTKVLQQPSTDLEFDRVVIYTTCLRVVRTTFERCELVRKIFQNHRVKFEEKNIALNGEYGK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GRXCR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 389207
Iso type IgG

Enviar uma mensagem


GRXCR1 polyclonal antibody

GRXCR1 polyclonal antibody