SEC31B polyclonal antibody
  • SEC31B polyclonal antibody

SEC31B polyclonal antibody

Ref: AB-PAB23700
SEC31B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEC31B.
Información adicional
Size 100 uL
Gene Name SEC31B
Gene Alias DKFZp434M183|SEC31B-1|SEC31L2
Gene Description SEC31 homolog B (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ATWLKSDVGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASASSAFFDELVPQNMTPWEIPITKDIDGLLSQALLLGELG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEC31B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25956
Iso type IgG

Enviar uma mensagem


SEC31B polyclonal antibody

SEC31B polyclonal antibody