METTL22 polyclonal antibody
  • METTL22 polyclonal antibody

METTL22 polyclonal antibody

Ref: AB-PAB23697
METTL22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant METTL22.
Información adicional
Size 100 uL
Gene Name METTL22
Gene Alias LP8272|C16orf68
Gene Description methyltransferase like 22
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RNIALNSHLAATGGGIVRVKELDWLKDDLCTDPKVPFSWSQEEISDLYDHTTILFAAEVFYDDDLTDAVFKTLSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human METTL22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79091
Iso type IgG

Enviar uma mensagem


METTL22 polyclonal antibody

METTL22 polyclonal antibody