METTL22 polyclonal antibody  View larger

Rabbit polyclonal antibody raised against recombinant METTL22.

AB-PAB23697

New product

METTL22 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name METTL22
Gene Alias LP8272|C16orf68
Gene Description methyltransferase like 22
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RNIALNSHLAATGGGIVRVKELDWLKDDLCTDPKVPFSWSQEEISDLYDHTTILFAAEVFYDDDLTDAVFKTLSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human METTL22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79091
Iso type IgG

More info

Rabbit polyclonal antibody raised against recombinant METTL22.

Enviar uma mensagem

Rabbit polyclonal antibody raised against recombinant METTL22.

Rabbit polyclonal antibody raised against recombinant METTL22.