TMEM116 polyclonal antibody
  • TMEM116 polyclonal antibody

TMEM116 polyclonal antibody

Ref: AB-PAB23685
TMEM116 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM116.
Información adicional
Size 100 uL
Gene Name TMEM116
Gene Alias FLJ90167
Gene Description transmembrane protein 116
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GNTSECFQNFSQSHKCILMHSPPSAMAELPPSANTSVCS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM116.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 89894
Iso type IgG

Enviar uma mensagem


TMEM116 polyclonal antibody

TMEM116 polyclonal antibody