ZMIZ2 polyclonal antibody
  • ZMIZ2 polyclonal antibody

ZMIZ2 polyclonal antibody

Ref: AB-PAB23684
ZMIZ2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZMIZ2.
Información adicional
Size 100 uL
Gene Name ZMIZ2
Gene Alias DKFZp761I2123|KIAA1886|ZIMP7|hZIMP7
Gene Description zinc finger, MIZ-type containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LMPSVMEMIAALGPGAAPFAPLQPPSVPAPSDYPGQGSSFLGPGTFPESFPPTTPSTPTLAEFTPGPPPISYQSDIPSSLLTSEKSTACLPSQMAPAGHLDPTHNPGTPGLHTSNL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZMIZ2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83637
Iso type IgG

Enviar uma mensagem


ZMIZ2 polyclonal antibody

ZMIZ2 polyclonal antibody