ADAT1 polyclonal antibody
  • ADAT1 polyclonal antibody

ADAT1 polyclonal antibody

Ref: AB-PAB23683
ADAT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ADAT1.
Información adicional
Size 100 uL
Gene Name ADAT1
Gene Alias HADAT1
Gene Description adenosine deaminase, tRNA-specific 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq IAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDTPDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ADAT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23536
Iso type IgG

Enviar uma mensagem


ADAT1 polyclonal antibody

ADAT1 polyclonal antibody