IGFALS polyclonal antibody
  • IGFALS polyclonal antibody

IGFALS polyclonal antibody

Ref: AB-PAB23681
IGFALS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IGFALS.
Información adicional
Size 100 uL
Gene Name IGFALS
Gene Alias ALS
Gene Description insulin-like growth factor binding protein, acid labile subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IGFALS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3483
Iso type IgG

Enviar uma mensagem


IGFALS polyclonal antibody

IGFALS polyclonal antibody