GRASP polyclonal antibody
  • GRASP polyclonal antibody

GRASP polyclonal antibody

Ref: AB-PAB23679
GRASP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GRASP.
Información adicional
Size 100 uL
Gene Name GRASP
Gene Alias TAMALIN
Gene Description GRP1 (general receptor for phosphoinositides 1)-associated scaffold protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VEMVTFVCRVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGTSIRKAELEARLQYLKQTLYEKWG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GRASP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 160622
Iso type IgG

Enviar uma mensagem


GRASP polyclonal antibody

GRASP polyclonal antibody