WDFY4 polyclonal antibody
  • WDFY4 polyclonal antibody

WDFY4 polyclonal antibody

Ref: AB-PAB23678
WDFY4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDFY4.
Información adicional
Size 100 uL
Gene Name WDFY4
Gene Alias C10orf64|FLJ17416|FLJ36288|FLJ45748|KIAA1607|MGC40604|MGC45899
Gene Description WDFY family member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VMDNLKSQSPLPEQSPCLLPGFRVLNDFLAHHVHIPEVYLIVSTFFLQTPLTELMDGPKDSLDAMLQWLLQRHHQEEVLQAGLCTEGALLLLEM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WDFY4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57705
Iso type IgG

Enviar uma mensagem


WDFY4 polyclonal antibody

WDFY4 polyclonal antibody