TMPRSS7 polyclonal antibody
  • TMPRSS7 polyclonal antibody

TMPRSS7 polyclonal antibody

Ref: AB-PAB23677
TMPRSS7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMPRSS7.
Información adicional
Size 100 uL
Gene Name TMPRSS7
Gene Alias -
Gene Description transmembrane protease, serine 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DESDELFCVSPQPACNTSSFRQHGPLICDGFRDCENGRDEQNCTQSIPCNNRTFKCGNDICFRKQNAKCD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMPRSS7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 344805
Iso type IgG

Enviar uma mensagem


TMPRSS7 polyclonal antibody

TMPRSS7 polyclonal antibody