WDR76 polyclonal antibody
  • WDR76 polyclonal antibody

WDR76 polyclonal antibody

Ref: AB-PAB23676
WDR76 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant WDR76.
Información adicional
Size 100 uL
Gene Name WDR76
Gene Alias CDW14|FLJ12973
Gene Description WD repeat domain 76
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EEVYRNERSSFSSFDFLAEDASTLIVGHWDGNMSLVDRRTPGTSYEKLTSSSMGKIRTVHVHPVHRQYFITAGLRDTHIYDARRLNSRRS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human WDR76.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79968
Iso type IgG

Enviar uma mensagem


WDR76 polyclonal antibody

WDR76 polyclonal antibody