PPTC7 polyclonal antibody
  • PPTC7 polyclonal antibody

PPTC7 polyclonal antibody

Ref: AB-PAB23673
PPTC7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPTC7.
Información adicional
Size 100 uL
Gene Name PPTC7
Gene Alias DKFZp686M07120|MGC133072|TA-PP2C|TAPP2C
Gene Description PTC7 protein phosphatase homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq LGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEY
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPTC7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 160760
Iso type IgG

Enviar uma mensagem


PPTC7 polyclonal antibody

PPTC7 polyclonal antibody