CCDC102A polyclonal antibody
  • CCDC102A polyclonal antibody

CCDC102A polyclonal antibody

Ref: AB-PAB23671
CCDC102A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC102A.
Información adicional
Size 100 uL
Gene Name CCDC102A
Gene Alias MGC10992|MGC13119
Gene Description coiled-coil domain containing 102A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SLDEQTEQSENLQVQLEHLQSRLRRQQQNAPLFGKIRSARFGTEEAEDGTSDLD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC102A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92922
Iso type IgG

Enviar uma mensagem


CCDC102A polyclonal antibody

CCDC102A polyclonal antibody