FAM154B polyclonal antibody
  • FAM154B polyclonal antibody

FAM154B polyclonal antibody

Ref: AB-PAB23666
FAM154B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM154B.
Información adicional
Size 100 uL
Gene Name FAM154B
Gene Alias DKFZp666G057
Gene Description family with sequence similarity 154, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QGLIGETAKLCRPVHTRVTQNALFEGSTEFRESFQPWEIPPPEVKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM154B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 283726
Iso type IgG

Enviar uma mensagem


FAM154B polyclonal antibody

FAM154B polyclonal antibody