PLAC8 polyclonal antibody
  • PLAC8 polyclonal antibody

PLAC8 polyclonal antibody

Ref: AB-PAB23662
PLAC8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PLAC8.
Información adicional
Size 100 uL
Gene Name PLAC8
Gene Alias C15|onzin
Gene Description placenta-specific 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PLAC8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51316
Iso type IgG

Enviar uma mensagem


PLAC8 polyclonal antibody

PLAC8 polyclonal antibody