FAM96A polyclonal antibody
  • FAM96A polyclonal antibody

FAM96A polyclonal antibody

Ref: AB-PAB23661
FAM96A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM96A.
Información adicional
Size 100 uL
Gene Name FAM96A
Gene Alias FLJ22875
Gene Description family with sequence similarity 96, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RIMEEKALEVYDLIRTIRDPEKPNTLEELEVVSESCVEVQEINEEEYLVIIRFTPTVPHCSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM96A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84191
Iso type IgG

Enviar uma mensagem


FAM96A polyclonal antibody

FAM96A polyclonal antibody