ARHGAP11A polyclonal antibody
  • ARHGAP11A polyclonal antibody

ARHGAP11A polyclonal antibody

Ref: AB-PAB23656
ARHGAP11A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARHGAP11A.
Información adicional
Size 100 uL
Gene Name ARHGAP11A
Gene Alias KIAA0013|MGC70740
Gene Description Rho GTPase activating protein 11A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DIGRVPDFILEKIPAMLGIDGLCATPSLEGFEEGEYETPGEYKRKRRQSVGDFVSGALNKFKPNRTPSITPQEERIAQLSESPVILTPNAKRT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARHGAP11A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9824
Iso type IgG

Enviar uma mensagem


ARHGAP11A polyclonal antibody

ARHGAP11A polyclonal antibody