CNNM1 polyclonal antibody
  • CNNM1 polyclonal antibody

CNNM1 polyclonal antibody

Ref: AB-PAB23655
CNNM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNNM1.
Información adicional
Size 100 uL
Gene Name CNNM1
Gene Alias ACDP1|FLJ31632
Gene Description cyclin M1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq TACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSLPCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLT
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CNNM1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26507
Iso type IgG

Enviar uma mensagem


CNNM1 polyclonal antibody

CNNM1 polyclonal antibody