CRYL1 polyclonal antibody
  • CRYL1 polyclonal antibody

CRYL1 polyclonal antibody

Ref: AB-PAB23654
CRYL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CRYL1.
Información adicional
Size 100 uL
Gene Name CRYL1
Gene Alias GDH|MGC149525|MGC149526|lambda-CRY
Gene Description crystallin, lambda 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLM
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CRYL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51084
Iso type IgG

Enviar uma mensagem


CRYL1 polyclonal antibody

CRYL1 polyclonal antibody