TOX3 polyclonal antibody
  • TOX3 polyclonal antibody

TOX3 polyclonal antibody

Ref: AB-PAB23652
TOX3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TOX3.
Información adicional
Size 100 uL
Gene Name TOX3
Gene Alias CAGF9|TNRC9
Gene Description TOX high mobility group box family member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TOX3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27324
Iso type IgG

Enviar uma mensagem


TOX3 polyclonal antibody

TOX3 polyclonal antibody